PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10006058m
Common NameEUTSA_v10006058mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 359aa    MW: 40240 Da    PI: 9.7522
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10006058mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.52.6e-4063140178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +CqvegC++dls++k+y++rhkvC +hsk+++v+v+gl+qrfCqqCsrfh+lsefD ekrsCrrrLa hnerrrk+qa
  Thhalv10006058m  63 RCQVEGCKMDLSNVKTYYSRHKVCCIHSKSSKVIVDGLHQRFCQQCSRFHQLSEFDSEKRSCRRRLACHNERRRKPQA 140
                      6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.8E-3160125IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.18861138IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-3762142IPR004333Transcription factor, SBP-box
PfamPF031101.1E-2964137IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0042127Biological Processregulation of cell proliferation
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MELLMDSGKN RTRSGGSSST ESSSSLSGGL RFGQKIYFED GSGSGAGSSK NRVKAVRKSL  60
TARCQVEGCK MDLSNVKTYY SRHKVCCIHS KSSKVIVDGL HQRFCQQCSR FHQLSEFDSE  120
KRSCRRRLAC HNERRRKPQA TTTLLTSRCS RLAPSLYGNA NAAMIRSVLG DPTTWTTARS  180
VMRRSAPWQI YPERENHQVM NVFAHGSSSF TTTTRSEMVN NISTDSNCAL SLLSNSNTIP  240
QQQQQQLQTS TNIWRPASGF ESTIADRVTM AQPPPVIIQH QYLNQTWEIM AGEKSNSQDM  300
SPVLGLRQIS EQDDFHRNNG TTMGGFESSL HQQVLRQYME PENTRAYDSS PQHFNWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-28641371184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00412DAPTransfer from AT3G57920Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402825.10.0hypothetical protein EUTSA_v10006058mg
SwissprotQ9M2Q60.0SPL15_ARATH; Squamosa promoter-binding-like protein 15
TrEMBLV4LWK60.0V4LWK6_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.5__2235__AT3G57920.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.11e-164squamosa promoter binding protein-like 15